| IED ID | IndEnz0002006335 |
| Enzyme Type ID | protease006335 |
| Protein Name |
Cell shape-determining protein MreC Cell shape protein MreC Rod shape-determining protein MreC |
| Gene Name | mreC |
| Organism | Geobacillus stearothermophilus (Bacillus stearothermophilus) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus stearothermophilus (Bacillus stearothermophilus) |
| Enzyme Sequence | MPNKRLMLLLLCIIILVAMIGFSLKGGRNTTWPEKVIGDTTGVFQNIFHTPAEFFAGIFENINDLKNTYKENERLREKLDGQTQYEAKLQELEEENKSLRDELGHVKSIKDYKPILATVIARSPDNWAKQVTINKGTQQNVAKDMAVTNEKGALIGKIKSSGLNNFTSAVQLLSDTDRNNRVATKISGKKGSKGYGLIEGYDKEKKRLKMTIIERKDKQDVKKGDLIETSGTGGVFPEGLTIGEVTDIESDSYGLTKVAYVKPAADLTDLNNVIVVNRDVPTVDTEEEGS |
| Enzyme Length | 290 |
| Uniprot Accession Number | P84480 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in formation and maintenance of cell shape. Regulates protease expression and stimulates the neutral protease production in Bacilli together with MreD. {ECO:0000250|UniProtKB:Q01466, ECO:0000269|PubMed:9063975}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Signal peptide (1) |
| Keywords | Cell shape;Coiled coil;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,141 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |