| IED ID | IndEnz0002006357 |
| Enzyme Type ID | protease006357 |
| Protein Name |
Protease PrsW EC 3.4.-.- |
| Gene Name | prsW sleB CD630_05520 |
| Organism | Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Clostridia Eubacteriales Peptostreptococcaceae Clostridioides Clostridioides difficile (Peptoclostridium difficile) Clostridioides difficile (strain 630) (Peptoclostridium difficile) |
| Enzyme Sequence | MKLDLFLLAIIPILIGMFWIRSKDRYCREPLIHLIKFFLIGAFLSVIIILLENLLMKFNVFEGYSELIYVSFVVAGLVEEGVKALILIPALIKEKHFTEKLDGIIYSVFLALGFATIENMVYIFSESRNLALQVGINRAVISIPAHVMFAITMGYYISKYKFEGNKNKRREYLFMAVLIPILLHGVFDFILMIEYRWAIILLIVYVIILWKINLDKLEKYMNHSKKVFFGNLRKKKKK |
| Enzyme Length | 238 |
| Uniprot Accession Number | Q188Z4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Involved in the degradation of specific anti-sigma factors, specifically RsiT. Involved in the regulation of extracytoplasmic function sigma factors expression. Seems to play a role in the resistance to antimicrobial peptides. Required for colonization or survival in the host cecum. {ECO:0000269|PubMed:21628514}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Topological domain (7); Transmembrane (7) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Transducer;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,827 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |