| IED ID | IndEnz0002006368 |
| Enzyme Type ID | protease006368 |
| Protein Name |
Cystatin Egg-white cystatin |
| Gene Name | |
| Organism | Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Perdicinae Coturnix Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) |
| Enzyme Sequence | SEGRSRLLGAPVPVRENDEGLQRALQFAMAEYNKASNDKYSSRVVRIISAKQQLVSGIKYIMEVEIGRTTCPKSSADLQSCEFHDEPEMAKYTTCNFVVYSIPWLNQIKLLKSSCQ |
| Enzyme Length | 116 |
| Uniprot Accession Number | P81061 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein binds tightly to and inhibits papain and cathepsin B. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Modified residue (1); Motif (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Phosphoprotein;Protease inhibitor;Secreted;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 80; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:9276465 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 53..57; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 13,093 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |