| IED ID | IndEnz0002006369 |
| Enzyme Type ID | protease006369 |
| Protein Name |
Cysteine proteinase inhibitor Cystatin |
| Gene Name | |
| Organism | Vigna unguiculata (Cowpea) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Vigna Vigna unguiculata (Cowpea) |
| Enzyme Sequence | MAALGGNRDVAGNQNSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFKHVGDAPA |
| Enzyme Length | 97 |
| Uniprot Accession Number | Q06445 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Helix (2); Motif (1); Site (1) |
| Keywords | 3D-structure;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4TX4; |
| Mapped Pubmed ID | 28389401; |
| Motif | MOTIF 49..53; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 10,758 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |