| IED ID | IndEnz0002006371 |
| Enzyme Type ID | protease006371 |
| Protein Name |
Neutrophil elastase 2B EC 3.4.21.- Proteinase 2B Fragments |
| Gene Name | |
| Organism | Equus caballus (Horse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
| Enzyme Sequence | IVGGRPARPHAWPFMASLQRRGGHFCGATLIMGWGQLGTNRPLPSVLQELNVTVVTAGICFGDSGGPLVCNGL |
| Enzyme Length | 73 |
| Uniprot Accession Number | P37358 |
| Absorption | |
| Active Site | ACT_SITE 64; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: May be involved in the degradation of connective tissue in chronic lung disease. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Non-adjacent residues (2) |
| Keywords | Direct protein sequencing;Hydrolase;Protease;Reference proteome;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,615 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |