IED ID | IndEnz0002006375 |
Enzyme Type ID | protease006375 |
Protein Name |
Enhancer of split M1 protein E spl m1 Kazal-type protease inhibitor m1 |
Gene Name | Kaz-m1 m1 GD21260 |
Organism | Drosophila simulans (Fruit fly) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila simulans (Fruit fly) |
Enzyme Sequence | MMSQTLTLCCLGLVACVYGNTVSTNDTACPTFCPSIYKPVCGTDGQNFKEFASTCNLLSHNCRRERNSVQAYAATDAAWCSSEFVENLHEKLGNFKLEVKECFKPCSMIYQPVCITNGKYRAELANSCLLENFNCALQVSGAQPAELFRLLREEKC |
Enzyme Length | 156 |
Uniprot Accession Number | B4QW11 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (5); Domain (2); Signal peptide (1); Site (2) |
Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Serine protease inhibitor;Signal |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 17,325 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |