Detail Information for IndEnz0002006386
IED ID IndEnz0002006386
Enzyme Type ID protease006386
Protein Name Glycinin G2
Glycinin 11S G2
Glycinin A2B1a
allergen Gly m 6

Cleaved into: Glycinin A2 subunit; Glycinin B1a subunit
Gene Name GY2 Glyma03g32020
Organism Glycine max (Soybean) (Glycine hispida)
Taxonomic Lineage cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida)
Enzyme Sequence MAKLVLSLCFLLFSGCFALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA
Enzyme Length 485
Uniprot Accession Number P04405
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Glycinin is the major seed storage protein of soybean (PubMed:2485233). Glycinin basic peptides (GBPs), and, to a lower extent, glycinin exhibit antibacterial activity against Gram-negative and Gram-positive bacteria (e.g. L.monocytogenes, B.subtilis, E.coli and S.enteritidis) by forming pores and aggregating in transmembranes, leading to membrane permeability and, eventually, cell death (PubMed:22236762, Ref.21, PubMed:28590128). {ECO:0000269|PubMed:22236762, ECO:0000269|PubMed:2485233, ECO:0000269|PubMed:28590128, ECO:0000269|Ref.21}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (2); Compositional bias (1); Disulfide bond (2); Domain (2); Motif (1); Natural variant (4); Propeptide (2); Region (3); Sequence conflict (5); Signal peptide (1)
Keywords Allergen;Direct protein sequencing;Disulfide bond;Endoplasmic reticulum;Reference proteome;Seed storage protein;Signal;Storage protein;Vacuole
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000250|UniProtKB:P04776}. Protein storage vacuole {ECO:0000250|UniProtKB:P04776}. Note=Hexamers are assembled in the endoplasmic reticulum and later sorted to the protein storage vacuoles. {ECO:0000250|UniProtKB:P04776}.
Modified Residue
Post Translational Modification PTM: During soybean germination, seed storage proteins are hydrolyzed by protease/26S proteasome. {ECO:0000269|PubMed:29037738}.
Signal Peptide SIGNAL 1..18; /evidence=ECO:0000269|PubMed:6541652
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 476..485; /note=Vacuolar targeting signal; /evidence=ECO:0000250|UniProtKB:P04776
Gene Encoded By
Mass 54,391
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda