| IED ID | IndEnz0002006396 |
| Enzyme Type ID | protease006396 |
| Protein Name |
Hirudin-HM2 Bufrudin Hirudin-HV1 |
| Gene Name | |
| Organism | Poecilobdella manillensis (Mexican medical leech) (Hirudinaria manillensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Poecilobdella Poecilobdella manillensis (Mexican medical leech) (Hirudinaria manillensis) |
| Enzyme Sequence | MFSLKLFVVFLAVCICVSQAVSYTDCTESGQNYCLCVGSNVCGEGKNCQLSSSGNQCVHGEGTPKPKSQTEGDFEEIPDEDILN |
| Enzyme Length | 84 |
| Uniprot Accession Number | P81492 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Glycosylation (1); Region (3); Sequence conflict (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence="ECO:0000269|PubMed:7685281, ECO:0000269|PubMed:8397794" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,004 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |