| IED ID | IndEnz0002006443 |
| Enzyme Type ID | protease006443 |
| Protein Name |
Membrane cofactor protein CD antigen CD46 |
| Gene Name | CD46 MCP |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MRASCTPLKAPLRRPERLASSGRFAWVLLLAPLLLLPTSSDACDDPPRFVSMKPQGTLKPSYSPGEQIVYECHLGFQPVTPGQVLALVCQDNNTWSSLQEGCKKRRCPTLADPTNGQVILVNGSTEFGSEVHYVCNNGYYLLGTNISYCEVSSGTGVNWSDNPPTCEKILCQPPPEIQNGKYTNSHKDVFEYNEVVTYSCDPSNGPDEYSLVGESKLTCIGNGEWSSQPPQCKVVKCVYPAIEHGTIVSGFGPKYYYKATVVLKCNEGFNLYGNSVVVCGENSTWEPELPKCIKGHPPRPTDASPPNGAEGLGAGYIVLVIVAVLIGVGLLLCLYCCFCRQRKKGIYVTGESHRQDILFSL |
| Enzyme Length | 361 |
| Uniprot Accession Number | Q6VE48 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. May act as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity (By similarity). In case of bovine viral diarrhea virus (BVDV) infection, involved in virus attachment to cells. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Disulfide bond (6); Domain (4); Glycosylation (3); Modified residue (2); Sequence conflict (9); Signal peptide (1); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Complement pathway;Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Fertilization;Glycoprotein;Immunity;Innate immunity;Membrane;Phosphoprotein;Reference proteome;Repeat;Signal;Sushi;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane {ECO:0000250}; Single-pass type I membrane protein {ECO:0000250}. Note=Inner acrosomal membrane of spermatozoa. {ECO:0000250}. |
| Modified Residue | MOD_RES Q6VE48-3:353; /note=Phosphotyrosine; /evidence=ECO:0000305; MOD_RES Q6VE48-3:356; /note=Phosphotyrosine; /evidence=ECO:0000305 |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:14747544}. |
| Signal Peptide | SIGNAL 1..42; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16571808; 21680116; 21869454; 27865262; 34839792; |
| Motif | |
| Gene Encoded By | |
| Mass | 39,391 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |