| IED ID | IndEnz0002006459 |
| Enzyme Type ID | protease006459 |
| Protein Name |
Extracellular metalloprotease MGYG_03559 EC 3.4.24.- |
| Gene Name | MGYG_03559 |
| Organism | Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae (dermatophytes) Nannizzia Arthroderma gypseum (Microsporum gypseum) Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum) |
| Enzyme Sequence | MRFSLSLIGLVASGSLAAAHPSHCGAEPSEDFDILSKDITDKLAAEASEIHAPIEVTTFFHVVASSKSVADGYISDKMLQDQLAVMNKAYAPHGFSFKHGNTTRTINPTWATGGDELNMKYALHMGKYADLNLYFVKKLADNSHGSCPYPSNPYPGTPGYIKDGCTILSSTVPGGSQSNANRGLTTVHEIGHYMGLYHTFQGGCSTELGDRVADTPAQKNGTVGCPSSRDSCPDQAGLDPIHNYMDTSDDVCRTEFTPKQAMRMQEMYKEFRAGK |
| Enzyme Length | 275 |
| Uniprot Accession Number | E4USP0 |
| Absorption | |
| Active Site | ACT_SITE 189; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (1); Glycosylation (2); Metal binding (2); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Secreted;Signal;Virulence;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,729 |
| Kinetics | |
| Metal Binding | METAL 188; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095; METAL 192; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Rhea ID | |
| Cross Reference Brenda |