| IED ID | IndEnz0002006504 |
| Enzyme Type ID | protease006504 |
| Protein Name |
Male accessory gland serine protease inhibitor Acrosin inhibitor Paragonial peptide D |
| Gene Name | PapD |
| Organism | Drosophila funebris (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Drosophila funebris group funebris subgroup Drosophila funebris (Fruit fly) |
| Enzyme Sequence | FKNPECGEPHSLDGSPNGISCRGYFPSWSYNPDAQQCVSFVYGGCGGNNNRFGSQNECEERCI |
| Enzyme Length | 63 |
| Uniprot Accession Number | P11424 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor. This peptide can inhibit, in-vivo, acrosin and, to a lower level, plasma kallikrein. It probably plays a role in Drosophila reproduction. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,911 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |