| IED ID | IndEnz0002006507 |
| Enzyme Type ID | protease006507 |
| Protein Name |
Trypsin inhibitor 2c BWI-2c |
| Gene Name | |
| Organism | Fagopyrum esculentum (Common buckwheat) (Polygonum fagopyrum) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Caryophyllales Polygonaceae Polygonoideae Fagopyreae Fagopyrum Fagopyrum esculentum (Common buckwheat) (Polygonum fagopyrum) |
| Enzyme Sequence | SEKPQQELEECQNVCRMKRWSTEMVHRCEKKCEEKFERQQR |
| Enzyme Length | 41 |
| Uniprot Accession Number | P86794 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits bovine trypsin with a Ki of 0.174 nM and trypsin-like proteases from G.mellonella larvae. Has no activity against serine proteases chymotrypsin, subtilisin and elastase. Has no activity against cysteine proteases from beetle gut. {ECO:0000269|PubMed:22612157}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 2LQX; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,186 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |