| IED ID | IndEnz0002006511 |
| Enzyme Type ID | protease006511 |
| Protein Name |
Alkaline proteinase inhibitor PrtA-specific inhibitor |
| Gene Name | inh prtI plu0656 |
| Organism | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Morganellaceae Photorhabdus Photorhabdus laumondii Photorhabdus luminescens subsp. laumondii Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Enzyme Sequence | MVFAAWYLKFAGFVALIFSIIGGSMASSLVLPHASELKGVWQLSDKHQQCDVLLTDHPLPEGSIWSLNGDNDCLAYMFGEVPAGWRPTPDGLTITDEQGSGLAFFAHEPDGWFARFADGRELMIKPNKTSKKNE |
| Enzyme Length | 134 |
| Uniprot Accession Number | Q7N8R2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of the alkaline protease. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Signal peptide (1) |
| Keywords | Disulfide bond;Metalloenzyme inhibitor;Metalloprotease inhibitor;Periplasm;Protease inhibitor;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,760 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |