| IED ID | IndEnz0002006564 |
| Enzyme Type ID | protease006564 |
| Protein Name |
Interferon antagonist K1L 32.5 kDa protein Host range protein 1 |
| Gene Name | VACWR032 K1L |
| Organism | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Enzyme Sequence | MDLSRINTWKSKQLKSFLSSKDAFKADVHGHSALYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAATLEDTKIVKILLFSGLDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSTFDLAILLSCIHITIKNGHVDMMILLLDYMTSTNTNNSLLFIPDIKLAIDNKDIEMLQALFKYDINIYSANLENVLLDDAEIAKMIIEKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLMYVNCVKKN |
| Enzyme Length | 284 |
| Uniprot Accession Number | P04297 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits antiviral activity induced by type I interferons. Does not block signal transduction of IFN, but is important to counter the host antiviral state induced by a pre-treatment with IFN. Plays a role in the inhibition of host NF-kappa-B activation by preventing the acetylation of the RELA/p65 subunit of NF-kappaB. {ECO:0000269|PubMed:19656868, ECO:0000269|PubMed:20089642, ECO:0000269|PubMed:21183678, ECO:0000269|PubMed:27503790}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Repeat (6); Sequence conflict (6) |
| Keywords | ANK repeat;Early protein;Host cytoplasm;Host nucleus;Host-virus interaction;Inhibition of host NF-kappa-B by virus;Inhibition of host innate immune response by virus;Reference proteome;Repeat;Viral immunoevasion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000269|PubMed:27503790}. Host nucleus {ECO:0000269|PubMed:27503790}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10781095; 22810585; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,467 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |