| IED ID | IndEnz0002006583 |
| Enzyme Type ID | protease006583 |
| Protein Name |
Penicillin-insensitive murein endopeptidase EC 3.4.24.- D-alanyl-D-alanine-endopeptidase DD-endopeptidase |
| Gene Name | mepA ECDH10B_2490 |
| Organism | Escherichia coli (strain K12 / DH10B) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) Escherichia coli (strain K12 / DH10B) |
| Enzyme Sequence | MNKTAIALLALLASSASLAATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPSGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVI |
| Enzyme Length | 274 |
| Uniprot Accession Number | B1X939 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Murein endopeptidase that cleaves the D-alanyl-meso-2,6-diamino-pimelyl amide bond that connects peptidoglycan strands. Likely plays a role in the removal of murein from the sacculus. {ECO:0000255|HAMAP-Rule:MF_01623}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Metal binding (6); Region (1); Signal peptide (1) |
| Keywords | Disulfide bond;Hydrolase;Metal-binding;Metalloprotease;Periplasm;Protease;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000255|HAMAP-Rule:MF_01623}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,137 |
| Kinetics | |
| Metal Binding | METAL 110; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 113; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 120; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 147; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 150; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 211; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 |
| Rhea ID | |
| Cross Reference Brenda |