| IED ID |
IndEnz0002006584 |
| Enzyme Type ID |
protease006584 |
| Protein Name |
Adapter protein MecA
|
| Gene Name |
mecA BpOF4_01905 |
| Organism |
Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) (Bacillus pseudofirmus) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Alkalihalobacillus
Alkalihalobacillus pseudofirmus (Bacillus pseudofirmus)
Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) (Bacillus pseudofirmus)
|
| Enzyme Sequence |
MDIERVNDTTIKFFITYKDIEDRGFDRDEIWYNRERGEELFFEMMNEANDRDEFELDGPLWIQVHALDKGLEIVVTRGQVSDGNVKLEIPVSQDKENTDENIVDLMTGHSSEDDEGIDTDQLEIVIGFNDFEDIISLSHNFFIDDLENELYHFEGRYYLHVLFNDDQYNEDEQDDMLSQMLEYGYETDLSIHRMQEYGKEIIGEYALKHLRGHFPQN |
| Enzyme Length |
217 |
| Uniprot Accession Number |
O66042 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC. {ECO:0000255|HAMAP-Rule:MF_01124}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Competence;Reference proteome;Sporulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
25,758 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|