| IED ID | IndEnz0002006627 |
| Enzyme Type ID | protease006627 |
| Protein Name |
Serine protease inhibitor Kazal-type 9 Lymphoepithelial Kazal-type-related inhibitor 2 |
| Gene Name | SPINK9 LEKTI2 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC |
| Enzyme Length | 86 |
| Uniprot Accession Number | Q5DT21 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which specifically inhibits KLK5. May contribute to the regulation of the desquamation process in skin by inhibiting KLK5. {ECO:0000269|PubMed:19190773, ECO:0000269|PubMed:19194479}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | O43765 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:19194479 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 21899598; 22505519; 24441102; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,756 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |