Detail Information for IndEnz0002006637
IED ID IndEnz0002006637
Enzyme Type ID protease006637
Protein Name Kallikrein-1
EC 3.4.21.35
Glandular kallikrein K1
KAL-B
Renal kallikrein
Tissue kallikrein-6
mGK-6
Gene Name Klk1 Klk-6 Klk6
Organism Mus musculus (Mouse)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse)
Enzyme Sequence MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND
Enzyme Length 261
Uniprot Accession Number P15947
Absorption
Active Site ACT_SITE 65; /note=Charge relay system; ACT_SITE 120; /note=Charge relay system; ACT_SITE 213; /note=Charge relay system
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.; EC=3.4.21.35;
DNA Binding
EC Number 3.4.21.35
Enzyme Function FUNCTION: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (1); Propeptide (1); Sequence conflict (1); Signal peptide (1)
Keywords Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen
Interact With
Induction
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..18; /evidence=ECO:0000305
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10456837; 11172053; 11217851; 11226291; 11282893; 12105144; 12437987; 12466851; 12933530; 12970725; 1334010; 14633138; 15033932; 15126916; 15131008; 15203212; 15331780; 15545270; 15584920; 16800724; 17006539; 17079272; 17210241; 17219431; 17465807; 1794058; 18086683; 18329172; 18627303; 18778305; 19164804; 19244588; 19262577; 19516248; 19549527; 19592578; 1981054; 19965931; 20624970; 21164105; 21695125; 22335454; 22622459; 22669897; 23280471; 24599937; 25410786; 25623731; 25628066; 28842604; 3036794; 3205728; 3649290; 6602295; 7525260; 7698777; 7749232; 8075499; 8188620; 8228186; 8452817; 8486351; 8617498; 8812484; 8833259; 8903733; 9122225; 9166596; 9355741; 9371744;
Motif
Gene Encoded By
Mass 28,775
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda 3.4.21.35;3.4.21.B10;