IED ID | IndEnz0002006666 |
Enzyme Type ID | protease006666 |
Protein Name |
Lipoprotein signal peptidase EC 3.4.23.36 LspMrs Prolipoprotein signal peptidase Signal peptidase II SPase II |
Gene Name | lspA SAUSA300_1089 |
Organism | Staphylococcus aureus (strain USA300) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain USA300) |
Enzyme Sequence | MHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGILSGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFIDTNIFGYDFPIFNIADSSLTIGVILIIIALLKDTSNKKEKEVK |
Enzyme Length | 163 |
Uniprot Accession Number | Q2FHP2 |
Absorption | |
Active Site | ACT_SITE 118; /evidence="ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000305|PubMed:31919415"; ACT_SITE 136; /evidence="ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000305|PubMed:31919415" |
Activity Regulation | ACTIVITY REGULATION: Inhibited by the antibiotics globomycin and myxovirescin. They act by blocking the catalytic dyad. {ECO:0000269|PubMed:31919415}. |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains.; EC=3.4.23.36; Evidence={ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000269|PubMed:31919415}; |
DNA Binding | |
EC Number | 3.4.23.36 |
Enzyme Function | FUNCTION: This protein specifically catalyzes the removal of signal peptides from prolipoproteins. {ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000269|PubMed:31919415}. |
Temperature Dependency | |
PH Dependency | |
Pathway | PATHWAY: Protein modification; lipoprotein biosynthesis (signal peptide cleavage). {ECO:0000255|HAMAP-Rule:MF_00161}. |
nucleotide Binding | |
Features | Active site (2); Chain (1); Mutagenesis (9); Topological domain (5); Transmembrane (4) |
Keywords | 3D-structure;Aspartyl protease;Cell membrane;Hydrolase;Membrane;Protease;Transmembrane;Transmembrane helix |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000269|PubMed:31919415}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00161, ECO:0000269|PubMed:31919415}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | X-ray crystallography (2) |
Cross Reference PDB | 6RYO; 6RYP; |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 18,342 |
Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=47 uM for P.aeruginosa inhibitor of cysteine peptidase {ECO:0000269|PubMed:31919415}; Vmax=2.5 nmol/min/mg enzyme with P.aeruginosa inhibitor of cysteine peptidase as substrate {ECO:0000269|PubMed:31919415}; |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |