| IED ID |
IndEnz0002006669 |
| Enzyme Type ID |
protease006669 |
| Protein Name |
Adapter protein MecA
|
| Gene Name |
mecA LEUM_1703 |
| Organism |
Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Lactobacillales
Lactobacillaceae
Leuconostoc
Leuconostoc mesenteroides
Leuconostoc mesenteroides subsp. mesenteroides
Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
|
| Enzyme Sequence |
MEKERINENTIRVMIDNSDLKDRGITVMELLGNHEKIESFFYNILSEVDTEHDFEDDDQVSFQILPNRNGLELFISRLDEENKISDILDNITNFSSKQPANIDNISDKRRQELRQSDKGDIVKSKVSSSDHKDGSQENFENTQVILALSDFENAIAIANSLKIENLVSDLYLYEGAYYLNLLVPDHSVSQEQLKNELAIALEFSRISHVTHEVLHEHGQLILKHEALEKIKSLFS |
| Enzyme Length |
235 |
| Uniprot Accession Number |
Q03VH8 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. {ECO:0000255|HAMAP-Rule:MF_01124}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Region (1) |
| Keywords |
|
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
27,002 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|