| IED ID |
IndEnz0002006670 |
| Enzyme Type ID |
protease006670 |
| Protein Name |
Adapter protein MecA
|
| Gene Name |
mecA SAG0139 |
| Organism |
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Lactobacillales
Streptococcaceae
Streptococcus
Streptococcus agalactiae
Streptococcus agalactiae serogroup V
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
|
| Enzyme Sequence |
MEMKQISETTLKITISMEDLEDRGMELKDFLIPQEKTEEFFYSVMDELDLPENFKNSGMLSFRVTPKKDRIDVFVTKSELSKDLNLEELADLGDISKMSPEDFFKTLEQSMLEKGDTDAHAKLAEIENMMDKATQEVVEENVSEEQPEKEVETIGYVHYVFDFDNIEAVVRFSQTIDFPIEASELYKNGKGYHMTILLDLENQPSYFANLMYARMLEHANVGTKTRAYLKEHSIQLIHDDAISKLQMIEMG |
| Enzyme Length |
251 |
| Uniprot Accession Number |
Q8E259 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. {ECO:0000255|HAMAP-Rule:MF_01124}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
29,055 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|