| IED ID | IndEnz0002006681 |
| Enzyme Type ID | protease006681 |
| Protein Name |
Bradykinin-potentiating peptide 25.12 BPP-25.12 |
| Gene Name | |
| Organism | Lychas mucronatus (Chinese swimming scorpion) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Lychas (bark scorpions) Lychas mucronatus (Chinese swimming scorpion) |
| Enzyme Sequence | MNKRVLLVIFFVTLLIADEVNSFSFFRKAKGFLKKIWKSKIARRLREKGMKALKNYANDVINGPAEAPAAAAAPEEPPVEQRRRRR |
| Enzyme Length | 86 |
| Uniprot Accession Number | P0CI93 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits angiotensin-converting enzyme (ACE), but does not serve as substrate for the enzyme. Potentiates bradykinin (BK) on the isolated guinea pig ileum as well as the isolated rat uterus for contraction. Also potentiates in vivo the depressor effect of BK on arterial blood pressure in the normotensive anesthetized rat. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,885 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |