| IED ID | IndEnz0002006733 |
| Enzyme Type ID | protease006733 |
| Protein Name |
Genome polyprotein Cleaved into: Envelope protein E Fragment |
| Gene Name | |
| Organism | Dengue virus type 2 (isolate Malaysia M3) (DENV-2) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Flasuviricetes Amarillovirales Flaviviridae Flavivirus (arboviruses group B) Dengue virus Dengue virus 2 Dengue virus type 2 (isolate Malaysia M3) (DENV-2) |
| Enzyme Sequence | MRCIGISNRDFVEGVSGGSWVDIVLEHGSCVTTMAKNKPTLDFEVIKTEAKQPATLRKSCFEAKLTNTTTESRCPTLGEPSLNEEQDKRLVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKFVHPENLEYTIVITPHSGEEHAVGNDTGKHGKELKITPQSSITEAELTGYGTVTMQCSPRTGLDFNEIVLLQMEDKAWLVHRQWFLDLPLPWLPGADTQGSNWIQKETLVTFKNPHAKKQDVVVLGSQEGAMQTALTGAAEIQMSSGNLLFTGHLKCRLRMDKLQLKGISYSMCTGKFKIVKEFAETQHGTIVIRVQYEGDGSPCKIPFEIIDLEKRHVLGCLITVYPIVTEKDSPVNIEADPPFGDSYIIIGIEPGQLKLHWLKKGSSIGQMFETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALNQVFGTIYGAAFSGVSWTMKILIGVIITCIGMNSRSTSLSVSLVLVGVVTLYLGGMVHA |
| Enzyme Length | 495 |
| Uniprot Accession Number | P14339 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Envelope protein E]: Binds to host cell surface receptor and mediates fusion between viral and cellular membranes. Envelope protein is synthesized in the endoplasmic reticulum in the form of heterodimer with protein prM. They play a role in virion budding in the ER, and the newly formed immature particle is covered with 60 spikes composed of heterodimer between precursor prM and envelope protein E. The virion is transported to the Golgi apparatus where the low pH causes dissociation of PrM-E heterodimers and formation of E homodimers. prM-E cleavage is inefficient, and many virions are only partially matured. These uncleaved prM would play a role in immune evasion. {ECO:0000250|UniProtKB:P17763}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (6); Glycosylation (2); Non-terminal residue (2); Region (1); Topological domain (3); Transmembrane (2) |
| Keywords | Clathrin-mediated endocytosis of virus by host;Cleavage on pair of basic residues;Disulfide bond;Fusion of virus membrane with host endosomal membrane;Fusion of virus membrane with host membrane;Glycoprotein;Host endoplasmic reticulum;Host membrane;Host-virus interaction;Membrane;Suppressor of RNA silencing;Transmembrane;Transmembrane helix;Viral attachment to host cell;Viral envelope protein;Viral nucleoprotein;Viral penetration into host cytoplasm;Virion;Virus endocytosis by host;Virus entry into host cell;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Envelope protein E]: Virion membrane {ECO:0000250|UniProtKB:P17763}; Multi-pass membrane protein {ECO:0000255}. Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P17763}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | PTM: [Envelope protein E]: N-glycosylated. {ECO:0000250|UniProtKB:P17763}.; PTM: [Genome polyprotein]: Specific enzymatic cleavages in vivo yield mature proteins. Cleavages in the lumen of endoplasmic reticulum are performed by host signal peptidase, wereas cleavages in the cytoplasmic side are performed by serine protease NS3. Signal cleavage at the 2K-4B site requires a prior NS3 protease-mediated cleavage at the 4A-2K site. {ECO:0000250|UniProtKB:P17763}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 54,120 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |