| IED ID | IndEnz0002006759 |
| Enzyme Type ID | protease006759 |
| Protein Name |
Cystatin Egg-white cystatin Ovocystatin |
| Gene Name | |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MAGARGCVVLLAAALMLVGAVLGSEDRSRLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ |
| Enzyme Length | 139 |
| Uniprot Accession Number | P01038 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein binds tightly to and inhibits a variety of thiol proteases including ficin, papain, and cathepsins B, C, H, and L. Although isolated from egg white, it is also present in serum. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (2); Helix (3); Modified residue (1); Motif (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Phosphoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | Q9N6S8 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 103; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:2721673 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence="ECO:0000269|PubMed:6662498, ECO:0000269|PubMed:6712597" |
| Structure 3D | NMR spectroscopy (2); X-ray crystallography (2) |
| Cross Reference PDB | 1A67; 1A90; 1CEW; 1YVB; |
| Mapped Pubmed ID | 14741212; 15336605; 16864794; 20085381; |
| Motif | MOTIF 76..80; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 15,287 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |