| IED ID | IndEnz0002006761 |
| Enzyme Type ID | protease006761 |
| Protein Name |
Cystatin Ovarian cystatin P12 |
| Gene Name | |
| Organism | Cyprinus carpio (Common carp) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Cyprinidae Cyprininae Cyprinus Cyprinus carpio (Common carp) |
| Enzyme Sequence | MYLKVIVLFLAVTLVVESTGIPGGLVDADINDKDVQKALRFAVDHYNGQSNDAFVRKVSKVIKVQQQVAAGMKYIFTVKMEVASCKKGGVKTMCAVPKNPSIEQVIQCKITVWSQPWLNSLKVTENTCM |
| Enzyme Length | 129 |
| Uniprot Accession Number | P35481 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cysteine proteinase inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Motif (1); Signal peptide (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically processed to produce two chains linked by a disulfide bridge. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000269|PubMed:8829807 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 67..71; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 14,236 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |