| IED ID | IndEnz0002006762 |
| Enzyme Type ID | protease006762 |
| Protein Name |
Cystatin-D Cystatin-5 |
| Gene Name | CST5 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV |
| Enzyme Length | 142 |
| Uniprot Accession Number | P28325 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B. {ECO:0000269|PubMed:8083219}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. {ECO:0000269|PubMed:8083219}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (2); Helix (1); Motif (1); Natural variant (1); Signal peptide (1); Site (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20189825}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000269|PubMed:8083219 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1RN7; 1ROA; |
| Mapped Pubmed ID | 18615156; 19662683; 20223287; 20379614; 26158294; 26364852; 28694499; |
| Motif | MOTIF 70..74; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 16,080 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |