| IED ID | IndEnz0002006765 |
| Enzyme Type ID | protease006765 |
| Protein Name |
Derlin-2.1 AtDerlin2-1 |
| Gene Name | DER2.1 At4g21810 F17L22.270 T8O5.20 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MAQAVEEWYKQMPIITRSYLTAAVVTTVGCSLEIISPYNLYLNPTLVVKQYQFWRLVTNFLYFRKMDLDFLFHMFFLARYCKLLEENSFRGKTADFLYMLLFGATVLTGIVLIGGMIPYLSVSFSKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAWGDFLGMIAGHAYYFLAFVYPRMTDRRPLKTPSFLKALFADEPVVIARPEDVRFAHAPFDEIHQD |
| Enzyme Length | 244 |
| Uniprot Accession Number | Q8VZ96 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous gene model prediction (3); Sequence conflict (2); Topological domain (5); Transmembrane (4) |
| Keywords | Endoplasmic reticulum;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12169696; 12853141; 15978049; 16783026; 18650403; 18775970; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,213 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |