| IED ID | IndEnz0002006773 |
| Enzyme Type ID | protease006773 |
| Protein Name |
Derlin-3 Der1-like protein 3 |
| Gene Name | DERL3 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MAWQGLATEFLQVPAVTRTYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALTAMLVYVWSRRSPGVRVNFFGLLTFQAPFLPWALMGLPMLLGNSILVDLLGIAVGHVYYFLEDVFPNQPGGKRLLLTPSFLKLLLDAPEEDPNYLPLPEEQPGPLQQ |
| Enzyme Length | 231 |
| Uniprot Accession Number | Q0P5E4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal glycoproteins, but not that of misfolded nonglycoproteins. May act by forming a channel that allows the retrotranslocation of misfolded glycoproteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the misfolded glycoproteins. May be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation. {ECO:0000250|UniProtKB:Q96Q80}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Topological domain (5); Transmembrane (4) |
| Keywords | Endoplasmic reticulum;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q96Q80}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q96Q80}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,248 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |