| IED ID | IndEnz0002006842 |
| Enzyme Type ID | protease006842 |
| Protein Name |
Bowman-Birk type proteinase inhibitor BBI |
| Gene Name | |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida) |
| Enzyme Sequence | MVVLKVCLVLLFLVGGTTSANLRLSKLGLLMKSDHQHSNDDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN |
| Enzyme Length | 110 |
| Uniprot Accession Number | P01055 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of trypsin and of chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Chain (1); Disulfide bond (7); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (2); X-ray crystallography (4) |
| Cross Reference PDB | 1BBI; 1D6R; 1K9B; 2BBI; 5J4Q; 5J4S; |
| Mapped Pubmed ID | 10772864; 15967577; 1734975; 7764974; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,092 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |