| IED ID | IndEnz0002006850 |
| Enzyme Type ID | protease006850 |
| Protein Name |
Metallopeptidase ImmA EC 3.4.-.- |
| Gene Name | immA ydcM BSU04810 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQANGLLQHDKATDQYLIHINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEHQASLFASELILTDKMLNEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSHEISAFG |
| Enzyme Length | 169 |
| Uniprot Accession Number | P96630 |
| Absorption | |
| Active Site | ACT_SITE 76; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Involved in the regulation of horizontal gene transfer through the integrative and conjugative element ICEBs1. Required for degradation of the ICEBs1 repressor protein ImmR/YdcN. {ECO:0000269|PubMed:18761623}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (2) |
| Keywords | Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,401 |
| Kinetics | |
| Metal Binding | METAL 75; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095; METAL 79; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Rhea ID | |
| Cross Reference Brenda |