Detail Information for IndEnz0002006873
IED ID IndEnz0002006873
Enzyme Type ID protease006873
Protein Name Extracellular metalloprotease ARB_05317
EC 3.4.24.-
Gene Name ARB_05317
Organism Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Arthrodermataceae (dermatophytes) Trichophyton Arthroderma benhamiae (Trichophyton mentagrophytes) Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
Enzyme Sequence MRFSVLLTGLAAAGSIATAERTCGAVPPRAYEKEFTEALNSLSPEAASADLTAGITIDTYLHVLTSGQTGNIPDSQLQAQINAMNQHYSQAGVQFKLVKATRTDNANWASGRDEAGMKKALHMGTYSSLNIYFIPNLSSGLLGICYFPRANPSQTTIIMDGCMVRSGTVPGGETTNYNQGKTATHEVGHFLGLYHVFSENGSCVDADMVADTPAQSKKTSGCPSSQDSCPGGGVDSIHNYMDYSYDVCMNQFTPGQANRIAQSWRAFRAGH
Enzyme Length 271
Uniprot Accession Number D4ALW9
Absorption
Active Site ACT_SITE 186; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.24.-
Enzyme Function FUNCTION: Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity). {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1); Disulfide bond (1); Glycosylation (2); Metal binding (2); Signal peptide (1)
Keywords Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Secreted;Signal;Virulence;Zinc
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21247460}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..19; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 28,942
Kinetics
Metal Binding METAL 185; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095; METAL 189; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095
Rhea ID
Cross Reference Brenda