| IED ID | IndEnz0002006891 |
| Enzyme Type ID | protease006891 |
| Protein Name |
Pre-hexon-linking protein VIII Pre-protein VIII pVIII Cleaved into: Hexon-linking protein-N 12.1 kDa protein VIII Protein VIII-N ; Hexon-linking protein-C 7.6 kDa protein VIII Protein VIII-C |
| Gene Name | L4 |
| Organism | Canine adenovirus serotype 2 (strain Toronto A 26-61) (CAdV-2) (Canine adenovirus 2 (strain Toronto A 26-61)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Canine mastadenovirus A Canine adenovirus serotype 2 (CAdV-2) (Canine adenovirus 2) Canine adenovirus serotype 2 (strain Toronto A 26-61) (CAdV-2) (Canine adenovirus 2 (strain Toronto A 26-61)) |
| Enzyme Sequence | MSKEIPTPYMWSYQPQTGHAAGASQDYSTQMNWFSAGPSMISQVYGIRDLRNKVLITQAEITKTPRTIMDPPIWPAAMLVQEAAPPKTVTLPRNHTLEQAMTNSGAQLAGGRQLCPSQIGIKSPVLAGTGIQLSEDIPSASWIRPDGIFQLGGGSRSSFSPTQAFLTLQQASSTPRAGGVGTYQFVREFVPEVYLNPFSGPPDTFPDQFIPNYDIVTNSVDGYD |
| Enzyme Length | 224 |
| Uniprot Accession Number | P68962 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Hexon-linking protein-N]: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together. {ECO:0000255|HAMAP-Rule:MF_04049}.; FUNCTION: [Hexon-linking protein-C]: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together. {ECO:0000255|HAMAP-Rule:MF_04049}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Peptide (2); Propeptide (1); Site (2) |
| Keywords | Capsid protein;Host nucleus;Late protein;Phosphoprotein;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000255|HAMAP-Rule:MF_04049}. |
| Subcellular Location | SUBCELLULAR LOCATION: [Hexon-linking protein-C]: Virion {ECO:0000255|HAMAP-Rule:MF_04049}. Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04049}.; SUBCELLULAR LOCATION: [Pre-hexon-linking protein VIII]: Host nucleus {ECO:0000255|HAMAP-Rule:MF_04049}.; SUBCELLULAR LOCATION: [Hexon-linking protein-N]: Virion {ECO:0000255|HAMAP-Rule:MF_04049}. Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04049}. |
| Modified Residue | MOD_RES 64; /note=Phosphothreonine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04049 |
| Post Translational Modification | PTM: Cleaved by the viral protease during virion maturation. May cause the middle segment to be shed from the capsid. {ECO:0000255|HAMAP-Rule:MF_04049}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,328 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |