| IED ID | IndEnz0002006898 |
| Enzyme Type ID | protease006898 |
| Protein Name |
Cysteine proteinase inhibitor 1 KCPI1 Phytocystatin |
| Gene Name | CYT1 CEY00_Acc20523 |
| Organism | Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Actinidiaceae Actinidia Actinidia chinensis (Kiwi) (Yangtao) Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) |
| Enzyme Sequence | MVPKPLSLLLLLLLALSAAVVGGRKRVAAGGWRPIENLNSAEVQDVAQFAVSEHNKQANDELQYQSVVRGYTQVVAGTNYRLVIAAKDGAVVGNYEAVVWDKPWMHFRNLTSFRKV |
| Enzyme Length | 116 |
| Uniprot Accession Number | P86472 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specific inhibitor of papain family cysteine proteinases. {ECO:0000250|UniProtKB:Q6TPK4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Glycosylation (1); Motif (1); Sequence conflict (2); Signal peptide (1); Site (1) |
| Keywords | Allergen;Direct protein sequencing;Glycoprotein;Plant defense;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01035}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 73..77; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P01035 |
| Gene Encoded By | |
| Mass | 12,792 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |