| IED ID | IndEnz0002006903 |
| Enzyme Type ID | protease006903 |
| Protein Name |
Elafin Elastase-specific inhibitor ESI Peptidase inhibitor 3 PI-3 Protease inhibitor WAP3 Skin-derived antileukoproteinase SKALP WAP four-disulfide core domain protein 14 |
| Gene Name | PI3 WAP3 WFDC14 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Enzyme Length | 117 |
| Uniprot Accession Number | P19957 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1) (PubMed:29483648). {ECO:0000269|PubMed:29483648}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (1); Disulfide bond (4); Domain (1); Helix (1); Natural variant (2); Propeptide (1); Region (1); Repeat (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:7685029 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (2) |
| Cross Reference PDB | 1FLE; 2REL; 6ATU; |
| Mapped Pubmed ID | 10066784; 10411887; 10771479; 11350120; 11466403; 11590230; 11667971; 12542536; 12819058; 12902340; 12970320; 14693682; 15034071; 15668324; 16279952; 16300411; 16336202; 16424380; 16639001; 16719916; 16913840; 16980310; 17139263; 17200145; 17489739; 17515931; 17964057; 18025118; 18092325; 18203972; 18700007; 18799464; 19095674; 19197381; 19251943; 19420899; 19723838; 19823954; 19824918; 19906197; 20126474; 20346360; 20371463; 20395631; 20932308; 21392745; 21466784; 21654840; 22634606; 23300756; 23320734; 23398087; 23637403; 23866880; 23885101; 24469047; 24617927; 24710505; 25195861; 25388519; 25405322; 25551582; 25559229; 26932165; 27580179; 28119996; 28187039; 28802561; 29084078; 30520152; 31131048; 32287314; 32460595; 32485443; 32764517; 33271565; 33679728; 34181952; 7543090; 8999895; 9395522; 9565599; 9727750; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,270 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |