| IED ID | IndEnz0002006935 |
| Enzyme Type ID | protease006935 |
| Protein Name |
Cystatin-like cysteine protease inhibitor EPIC3 Extracellular protease inhibitor with cystatin-like domain protein 3 Secreted effector EPIC3 |
| Gene Name | EPIC3 |
| Organism | Phytophthora infestans (Potato late blight agent) (Botrytis infestans) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora infestans (Potato late blight agent) (Botrytis infestans) |
| Enzyme Sequence | MAFTRSIALFAGLALAASSAQEATILGGYTQKNATSDDIELLTQATSSANMYNKNVDTRICLIAIENLETQTVAGTNYKFQVAGCPVETDDELGACDDRNCDYSSYNIVIFSQPWSDTIEVTSITPAEYQG |
| Enzyme Length | 131 |
| Uniprot Accession Number | A1L018 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Secreted effector that interacts with and inhibits host apoplastic pathogenesis-related papain-like cysteine proteases (Probable). Inhibition of host proteases by a pathogen extracellular protease inhibitor forms a specific type of defense-counterdefense mechanism between plants and microbial pathogens (Probable). {ECO:0000305|PubMed:17085509}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Glycoprotein;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor;Virulence |
| Interact With | |
| Induction | INDUCTION: Expressed during infection of host plant and in germinating cysts. {ECO:0000269|PubMed:17085509}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:17085509}. Note=Localizes to host apoplast where it targets defense proteases for inhibition. {ECO:0000305|PubMed:17085509}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 71..75; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P01040 |
| Gene Encoded By | |
| Mass | 14,125 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |