IED ID | IndEnz0002006936 |
Enzyme Type ID | protease006936 |
Protein Name |
Cystatin-like cysteine protease inhibitor EPIC3 Extracellular protease inhibitor with cystatin-like domain protein 3 Secreted effector EPIC3 |
Gene Name | EPIC3 PITG_14891 |
Organism | Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora infestans (Potato late blight agent) (Botrytis infestans) Phytophthora infestans (strain T30-4) (Potato late blight fungus) |
Enzyme Sequence | MAFTRSIALFAGLALAASSAQGATILGGYTQKNATSDDIELLTQATSSANMYNKNVDTRICLIAIENLETQTVAGTNYKFQVAGCPVETDDELGACDDRNCDYSSYNIVIFSQPWSDTIEVTSITPAEYQG |
Enzyme Length | 131 |
Uniprot Accession Number | D0NP95 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Secreted effector that interacts with and inhibits host apoplastic pathogenesis-related papain-like cysteine proteases (Probable). Inhibition of host proteases by a pathogen extracellular protease inhibitor forms a specific type of defense-counterdefense mechanism between plants and microbial pathogens (Probable). {ECO:0000305|PubMed:17085509}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Glycosylation (1); Motif (1); Signal peptide (1); Site (1) |
Keywords | Glycoprotein;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor;Virulence |
Interact With | |
Induction | INDUCTION: Expressed during infection of host plant and in germinating cysts. {ECO:0000269|PubMed:17085509}. |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:17085509}. Note=Localizes to host apoplast where it targets defense proteases for inhibition. {ECO:0000305|PubMed:17085509}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 71..75; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P01040 |
Gene Encoded By | |
Mass | 14,053 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |