| IED ID | IndEnz0002006961 |
| Enzyme Type ID | protease006961 |
| Protein Name |
Kunitz trypsin inhibitor 5 AtKTI5 Kunitz trypsin inhibitor 2 AtKTI2 |
| Gene Name | KTI5 KTI2 At1g17860 F2H15.9 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSSLLYIFLLLAVFISHRGVTTEAAVEPVKDINGKSLLTGVNYYILPVIRGRGGGLTMSNLKTETCPTSVIQDQFEVSQGLPVKFSPYDKSRTIPVSTDVNIKFSPTSIWELANFDETTKQWFISTCGVEGNPGQKTVDNWFKIDKFEKDYKIRFCPTVCNFCKVICRDVGVFVQDGKRRLALSDVPLKVMFKRAY |
| Enzyme Length | 196 |
| Uniprot Accession Number | Q9LMU2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Can inhibit both serine proteases and cysteine proteases (PubMed:30042779). May be involved in the modulation of the proteases that participate in the hydrolysis of dietary proteins in the gut of spider mites (PubMed:30042779). {ECO:0000269|PubMed:30042779}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Signal peptide (1) |
| Keywords | Disulfide bond;Endoplasmic reticulum;Plant defense;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Induced by infestation with spider mites. {ECO:0000269|PubMed:30042779}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000269|PubMed:30042779}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15593128; 15763661; 16258017; 18166134; 18538804; 18650403; 18796151; 20484005; 21798944; 27247031; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,082 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |