IED ID | IndEnz0002006985 |
Enzyme Type ID | protease006985 |
Protein Name |
Pre-hexon-linking protein VIII Pre-protein VIII pVIII Cleaved into: Hexon-linking protein-N 12.1 kDa protein VIII Protein VIII-N ; Hexon-linking protein-C 7.6 kDa protein VIII Protein VIII-C |
Gene Name | L4 |
Organism | Murine adenovirus A serotype 1 (MAdV-1) (Murine adenovirus 1) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Murine mastadenovirus A Murine adenovirus A serotype 1 (MAdV-1) (Murine adenovirus 1) |
Enzyme Sequence | MSAPSPYVWTFQPQRGTAAGASQDYSTRINWLSAGPELRGKVVQLNEARNAILMKEQESVPTPRAEANPSFWPAALIFQPRPQAIPVHPAHPDTFDAALTSNGAQLAGGAWINYKNGSVRYEAPLQLAEEQVGGPLNAFAIKHQLQLAGGALSASMSEMSGAPRIPRSGGIGSWQFSREFPPTVYLNPFSGSPDTFPHQFLSNYDSFSHTVDGYD |
Enzyme Length | 215 |
Uniprot Accession Number | P19722 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: [Hexon-linking protein-N]: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together. {ECO:0000255|HAMAP-Rule:MF_04049}.; FUNCTION: [Hexon-linking protein-C]: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together. {ECO:0000255|HAMAP-Rule:MF_04049}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Modified residue (1); Peptide (2); Propeptide (1); Site (2) |
Keywords | Capsid protein;Host nucleus;Late protein;Phosphoprotein;Virion |
Interact With | |
Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000255|HAMAP-Rule:MF_04049}. |
Subcellular Location | SUBCELLULAR LOCATION: [Hexon-linking protein-C]: Virion {ECO:0000255|HAMAP-Rule:MF_04049}. Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04049}.; SUBCELLULAR LOCATION: [Pre-hexon-linking protein VIII]: Host nucleus {ECO:0000255|HAMAP-Rule:MF_04049}.; SUBCELLULAR LOCATION: [Hexon-linking protein-N]: Virion {ECO:0000255|HAMAP-Rule:MF_04049}. Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. {ECO:0000255|HAMAP-Rule:MF_04049}. |
Modified Residue | MOD_RES 62; /note=Phosphothreonine; by host; /evidence=ECO:0000255|HAMAP-Rule:MF_04049 |
Post Translational Modification | PTM: Cleaved by the viral protease during virion maturation. May cause the middle segment to be shed from the capsid. {ECO:0000255|HAMAP-Rule:MF_04049}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 23,272 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |