IED ID | IndEnz0002007003 |
Enzyme Type ID | protease007003 |
Protein Name |
Neutrophil elastase 2A EC 3.4.21.- Proteinase 2A Fragments |
Gene Name | |
Organism | Equus caballus (Horse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
Enzyme Sequence | IVGGRAAEPHSRPYMVSLQIRGNPGSHFCGGTLIMGWGRLGTREPLPXVLQELNVTVVTAGICFGDSGGPLICNGVAQGVFSFVR |
Enzyme Length | 85 |
Uniprot Accession Number | P37357 |
Absorption | |
Active Site | ACT_SITE 67; /note=Charge relay system |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.21.- |
Enzyme Function | FUNCTION: May be involved in the degradation of connective tissue in chronic lung disease. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Domain (1); Non-adjacent residues (2) |
Keywords | Direct protein sequencing;Hydrolase;Protease;Reference proteome;Serine protease |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 8,893 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |