| IED ID | IndEnz0002007010 |
| Enzyme Type ID | protease007010 |
| Protein Name |
FAS-associated death domain protein FAS-associating death domain-containing protein Growth-inhibiting gene 3 protein Mediator of receptor induced toxicity |
| Gene Name | FADD MORT1 GIG3 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
| Enzyme Length | 208 |
| Uniprot Accession Number | Q13158 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors (PubMed:7538907, PubMed:23955153, PubMed:19118384, PubMed:20935634, PubMed:16762833, PubMed:24025841). The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation (PubMed:7538907, PubMed:19118384, PubMed:20935634, PubMed:16762833). Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis (PubMed:16762833). Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling (PubMed:21109225). {ECO:0000269|PubMed:16762833, ECO:0000269|PubMed:19118384, ECO:0000269|PubMed:20935634, ECO:0000269|PubMed:21109225, ECO:0000269|PubMed:23955153, ECO:0000269|PubMed:24025841, ECO:0000269|PubMed:7538907}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Domain (2); Glycosylation (1); Helix (13); Modified residue (1); Mutagenesis (16); Natural variant (1); Region (1); Sequence conflict (1); Turn (1) |
| Keywords | 3D-structure;Apoptosis;Disease variant;Glycoprotein;Host-virus interaction;Immunity;Innate immunity;Phosphoprotein;Reference proteome |
| Interact With | P62324; Q14790; Q14790-1; Q14790-5; Q96D03; Itself; B7ZLH0; P25445; P25445-1; P48023; Q5S007; O95243; Q99836; Q99497; P53350; Q13546; P78317; O00560; Q15560; Q15628; Q7KZS0; Q6PEW1; Q9UJ78-2; P25446; B7UI21 |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 194; /note="Phosphoserine"; /evidence="ECO:0000269|PubMed:11034606, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" |
| Post Translational Modification | PTM: (Microbial infection) Glycosylated at Arg-117 by enteropathogenic E.coli protein NleB1, C.rodentium protein NleB and S.typhimurium protein Ssek1: arginine GlcNAcylation prevents recruitment of caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. {ECO:0000269|PubMed:23955153, ECO:0000269|PubMed:24025841, ECO:0000269|PubMed:28069818, ECO:0000269|PubMed:28860194}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (5); X-ray crystallography (3) |
| Cross Reference PDB | 1A1W; 1A1Z; 1E3Y; 1E41; 2GF5; 3EZQ; 3OQ9; 6ACI; |
| Mapped Pubmed ID | 10235259; 10521396; 10640736; 10837247; 10880445; 10894160; 11002417; 11112409; 11384965; 11463813; 11717445; 11752160; 11805265; 11877464; 11975981; 12037669; 12107169; 12122017; 12181749; 12196516; 12198154; 12215447; 12220669; 12235128; 12482751; 12496482; 12499380; 12604344; 12620239; 12620240; 12721308; 12752666; 12815462; 12851487; 12884866; 12887920; 12912912; 12954630; 14573612; 14612908; 14739303; 15001534; 15024054; 15034549; 15069192; 15073179; 15173180; 15280356; 15289496; 15452117; 15452120; 15485835; 15601308; 15645452; 15760909; 15778222; 15814722; 15906275; 15916534; 15956881; 16003390; 16006552; 16061179; 16109772; 16169070; 16177127; 16258269; 16289096; 16339514; 16410793; 16450001; 16498403; 16528386; 16538383; 16585540; 16611992; 16618810; 16710361; 16844082; 16871589; 16937440; 17031492; 17047155; 17159907; 17235653; 17327223; 17511679; 17656375; 17911615; 17977957; 18174230; 18190721; 18256533; 18328427; 18485876; 18632964; 18761323; 18813792; 18838202; 18840411; 19074885; 19176810; 19278658; 19303913; 19336038; 19362094; 19364499; 19415536; 19416807; 19427028; 19453261; 19524512; 19524513; 19557578; 19573080; 19583773; 19683492; 19773279; 19955841; 20040024; 20070122; 20097879; 20103630; 20218968; 20308068; 20353946; 20420860; 20438666; 20484047; 20588308; 20696707; 20711500; 20802294; 20890306; 20943999; 20947025; 20951169; 21048031; 21115735; 21183682; 21235526; 21315423; 21382479; 21458669; 21459798; 21525013; 21525171; 21613217; 21625644; 21706480; 21737329; 21737330; 21785459; 21803845; 21822306; 21894190; 21900206; 21978935; 21979465; 21988832; 22126763; 22130896; 22173242; 22253026; 22266862; 22274400; 22421964; 22817896; 22838074; 22864571; 22922561; 23096115; 23285096; 23606538; 23678861; 23760276; 23763459; 24316133; 24355299; 24434721; 24548998; 24603611; 24752353; 24886289; 24901053; 25043603; 25075716; 25129245; 25241761; 25305096; 25643035; 25790448; 25911380; 26253696; 26419589; 26437781; 26808319; 26972597; 26995783; 27013580; 27213693; 27556297; 27746017; 27764170; 27799292; 27974463; 28061540; 28189684; 28212752; 28302628; 28320441; 28393201; 28618251; 29472595; 29681455; 29795330; 30190126; 30354994; 30401514; 30536547; 30628514; 30804327; 30805584; 31239234; 31511692; 32303335; 32350755; 32368989; 33009373; 33104018; 33547302; 33800107; 34423028; 8681376; 9045686; 9343261; 9721089; 9880531; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,279 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |