| IED ID | IndEnz0002007011 |
| Enzyme Type ID | protease007011 |
| Protein Name |
Antifungal protein ginkbilobin-2 Antimicrobial protein Gnk2-1 |
| Gene Name | GNK2 GNK2-1 |
| Organism | Ginkgo biloba (Ginkgo) (Maidenhair tree) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Acrogymnospermae Ginkgoopsida Ginkgoidae Ginkgoales Ginkgoaceae Ginkgo Ginkgo biloba (Ginkgo) (Maidenhair tree) |
| Enzyme Sequence | MKTMRMNSAFILAFALAAAMLILTEAANTAFVSSACNTQKIPSGSPFNRNLRAMLADLRQNTAFSGYDYKTSRAGSGGAPTAYGRATCKQSISQSDCTACLSNLVNRIFSICNNAIGARVQLVDCFIQYEQRSF |
| Enzyme Length | 134 |
| Uniprot Accession Number | A4ZDL6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 37; /note=Alpha-D-mannose; /evidence=ECO:0007744|PDB:4XRE; BINDING 119; /note=Alpha-D-mannose; /evidence=ECO:0007744|PDB:4XRE; BINDING 130; /note=Alpha-D-mannose; /evidence=ECO:0007744|PDB:4XRE |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Possesses antifungal activity against F.oxysporum, T.reesei and C.albicans. Weakly inhibits the aspartic acid protease pepsin activity (PubMed:17338634). Exerts antifungal activity against S.cerevisiae and F.culmorum through its carbohydrate-binding specificity. Acts as a lectin that stricly recognizes alpha-1,2-linked mannose moieties and interacts with the yeast cell wall mannan polysaccharide (PubMed:25139159). Can interfere with the fungal actin remodeling resulting to the activation of an actin-dependent cell death (PubMed:26315821). {ECO:0000269|PubMed:17338634, ECO:0000269|PubMed:25139159, ECO:0000269|PubMed:26315821}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Binding site (3); Chain (1); Disulfide bond (3); Domain (1); Helix (4); Mutagenesis (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | 3D-structure;Actin-binding;Antibiotic;Antimicrobial;Apoptosis;Direct protein sequencing;Disulfide bond;Fungicide;Lectin;Mannose-binding;Plant defense;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:26315821}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 3A2E; 4XRE; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,473 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |