| IED ID | IndEnz0002007029 |
| Enzyme Type ID | protease007029 |
| Protein Name |
Serine protease inhibitor Kazal-type 2 Acrosin-trypsin inhibitor |
| Gene Name | SPINK2 |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Macaca (macaques) Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Enzyme Sequence | MALAVLRLALLLLAVTFAGPLFRRFSKYKTPFCARYQLPGCPRDFNPVCGTDMITYPNECTLCMKIRESGQNIKILRRGPC |
| Enzyme Length | 81 |
| Uniprot Accession Number | P34953 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strong inhibitor of acrosin in male and/or female genital tract. Also inhibits trypsin (By similarity). {ECO:0000250}.; FUNCTION: As a strong inhibitor of acrosin, it is required for normal spermiogenesis. It probably hinders premature activation of proacrosin and other proteases, thus preventing the cascade of events leading to spermiogenesis defects (By similarity). May be involved in the regulation of serine protease-dependent germ cell apoptosis (By similarity). It also inhibits trypsin (By similarity). {ECO:0000250|UniProtKB:P20155, ECO:0000250|UniProtKB:Q8BMY7}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Cytoplasmic vesicle;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P20155}. Cytoplasmic vesicle, secretory vesicle, acrosome {ECO:0000250|UniProtKB:P20155}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,171 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |