| IED ID | IndEnz0002007031 |
| Enzyme Type ID | protease007031 |
| Protein Name |
Serine protease Do-like HtrA EC 3.4.21.107 HtrA-like serine protease |
| Gene Name | htrA ykdA BSU12900 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MDNYRDENRTKGNENEVFLTKENDQSASYSARNVIHDQEKKKRGFGWFRPLLGGVIGGSLALGIYTFTPLGDHDSQDTAKQSSSQQQTQSVTATSTSSESKKSSSSSSAFKSEDSSKISDMVEDLSPAIVGITNLQAQSNSSLFGSSSSDSSEDTESGSGSGVIFKKENGKAYIITNNHVVEGASSLKVSLYDGTEVTAKLVGSDSLTDLAVLQISDDHVTKVANFGDSSDLRTGETVIAIGDPLGKDLSRTVTQGIVSGVDRTVSMSTSAGETSINVIQTDAAINPGNSGGPLLNTDGKIVGINSMKISEDDVEGIGFAIPSNDVKPIAEELLSKGQIERPYIGVSMLDLEQVPQNYQEGTLGLFGSQLNKGVYIREVASGSPAEKAGLKAEDIIIGLKGKEIDTGSELRNILYKDAKIGDTVEVKILRNGKEMTKKIKLDQKEEKTS |
| Enzyme Length | 449 |
| Uniprot Accession Number | O34358 |
| Absorption | |
| Active Site | ACT_SITE 179; /note=Charge relay system; /evidence=ECO:0000255; ACT_SITE 209; /note=Charge relay system; /evidence=ECO:0000255; ACT_SITE 290; /note=Charge relay system; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Acts on substrates that are at least partially unfolded. The cleavage site P1 residue is normally between a pair of hydrophobic residues, such as Val-|-Val.; EC=3.4.21.107; |
| DNA Binding | |
| EC Number | 3.4.21.107 |
| Enzyme Function | FUNCTION: Degrades abnormal exported proteins and responsible for the propeptide processing of a natural pro-protein and for the maturation of a native protein. It also plays a prominent role in stress (heat shock, ethanol, puromycin and NaCl) resistance during active exponential growth (Probable). {ECO:0000305|PubMed:11133960}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Compositional bias (4); Domain (1); Region (5); Sequence conflict (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Serine protease;Stress response;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Transcription is CssS dependent. Induced by heat shock during exponential growth and by heterologous amylases at the transition phase of the growth cycle. Negatively regulates its own expression during exponential growth and during heat shock. {ECO:0000269|PubMed:10692364, ECO:0000269|PubMed:11133960, ECO:0000269|PubMed:11555295}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 21630458; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,715 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |