| IED ID | IndEnz0002007085 |
| Enzyme Type ID | protease007085 |
| Protein Name |
Cell cycle transcriptional regulator CtrA Response regulator SokA |
| Gene Name | ctrA sokA CCNA_03130 |
| Organism | Caulobacter vibrioides (strain NA1000 / CB15N) (Caulobacter crescentus) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Caulobacterales Caulobacteraceae Caulobacter Caulobacter vibrioides (Caulobacter crescentus) Caulobacter vibrioides (strain NA1000 / CB15N) (Caulobacter crescentus) |
| Enzyme Sequence | MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVDLGKIYDYDLILLDLNLPDMSGIDVLRTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSKGHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLAASAHGKHHIETVWGRGYVLRDPNEQVNAA |
| Enzyme Length | 231 |
| Uniprot Accession Number | B8H358 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 124..223; /note=OmpR/PhoB-type; /evidence=ECO:0000255|PROSITE-ProRule:PRU01091 |
| EC Number | |
| Enzyme Function | FUNCTION: Forms part of a two-component regulatory system CtrA/CckA that controls multiple events in the cell cycle, including cell division, stalk synthesis and cell cycle-specific transcription. Binds to a group of cell cycle-regulated promoters critical for DNA replication, DNA methylation, and class II flagellar biogenesis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1); Modified residue (1); Mutagenesis (1) |
| Keywords | DNA-binding;Phosphoprotein;Reference proteome;Transcription;Transcription regulation;Two-component regulatory system |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 51; /note=4-aspartylphosphate; /evidence=ECO:0000255|PROSITE-ProRule:PRU00169 |
| Post Translational Modification | PTM: Phosphorylated by CckA. Degraded by the ClpXP protease (PubMed:9755166). {ECO:0000269|PubMed:9755166}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,796 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |