| IED ID | IndEnz0002007137 |
| Enzyme Type ID | protease007137 |
| Protein Name |
Bowman-Birk type proteinase inhibitor LaBBI |
| Gene Name | |
| Organism | Lupinus albus (White lupine) (Lupinus termis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) |
| Enzyme Sequence | SLASKPCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPCTSS |
| Enzyme Length | 63 |
| Uniprot Accession Number | P85172 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin stoichiometrically at the molar ratio of 1:2, with a dissociation constant of 4.2 nM. Does not inhibit chymotrypsin. {ECO:0000269|PubMed:18474386}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. {ECO:0000269|PubMed:18474386}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Stable at low pH. {ECO:0000269|PubMed:18474386}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Natural variant (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,872 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |