| IED ID | IndEnz0002007138 |
| Enzyme Type ID | protease007138 |
| Protein Name |
Latexin Endogenous carboxypeptidase inhibitor ECI Tissue carboxypeptidase inhibitor TCI |
| Gene Name | Lxn |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MEEIPPTHYAASRAASVAENCINYQQGTPNKVFKVQTVQQASKEDIPGRGHKYHLKFSVEEIIQKQVTVSCTAEVLYPRMGQGSAPEVNFTFEGEIGKNPDEEDNTFYQRLMSMKEPLQAQNIPDNFGNVSPQMKPVHHLAWVACGYVMWQNSTEDTWYKMAKIQTVKQVQRNDDFIELDYTVLLHDVASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEAPAE |
| Enzyme Length | 223 |
| Uniprot Accession Number | Q64361 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation (By similarity). {ECO:0000250, ECO:0000269|PubMed:8618874}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Region (3) |
| Keywords | Acetylation;Cytoplasm;Direct protein sequencing;Heparin-binding;Inflammatory response;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Repeat |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | MOD_RES 56; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9BS40 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 22206666; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,580 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |