| IED ID | IndEnz0002007169 |
| Enzyme Type ID | protease007169 |
| Protein Name |
Bradykinin-potentiating peptide NDBP6 BPP-6 |
| Gene Name | |
| Organism | Lychas mucronatus (Chinese swimming scorpion) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Lychas (bark scorpions) Lychas mucronatus (Chinese swimming scorpion) |
| Enzyme Sequence | MNKKTLLVIFFVTMLIVDEVNSFRFGSFLKKVWKSKLAKKLRSKGKQLLKDYANRVLNGPEEEAAAPAERRR |
| Enzyme Length | 72 |
| Uniprot Accession Number | D9U2B5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Amphipathic peptide that shows bradykinin potentiating activity and antimicrobial activities against bacteria and fungi. Has higher antibacterial activities against Gram-negative than against Gram-positive bacteria. Also inhibits NADPH oxidase-dependent superoxide production (IC(50) is 0.4 uM on granulocytes stimulated with PMA, IC(50) is 0.51 uM on HL-60 cells undifferentiated and IC(50) is 0.53 uM on HL-60 cells treated with DMSO). The C-terminal peptide shows a higher bradykinin potentiating activity than the complete peptide. {ECO:0000250|UniProtKB:Q9Y0X4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20663230}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,355 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |