| IED ID | IndEnz0002007178 |
| Enzyme Type ID | protease007178 |
| Protein Name |
Putative 26S proteasome non-ATPase regulatory subunit 8 homolog B 26S proteasome regulatory subunit RPN12b AtRPN12b 26S proteasome regulatory subunit S14 homolog B |
| Gene Name | RPN12B At5g42040 MJC20.14 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MDPQLMEVSQQFERFKAAFIIKDFDTCSSLLSQLKLFDHYLISLSLNALLLLTCALFFLCTRNRIPPSPQENLIMGLNLLRLLVQNRIAEFHTELGLLSSATLENPCIKHAVELEQSFMEGAYNRVLSARQTAPDETYVYFMDLLAKTIRDEIAGCSEKAYDHLSISEGCKMLLFSSDQQLLTYVNEEHPEWEVKDGLVVFQKTRETAPCKEIPSLQLINQTLSYTRELERIL |
| Enzyme Length | 233 |
| Uniprot Accession Number | Q9FHY0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. {ECO:0000250|UniProtKB:Q9SGW3}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous gene model prediction (1); Modified residue (1) |
| Keywords | Acetylation;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:Q9SGW3 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11826296; 16297073; 17825468; 18783601; |
| Motif | |
| Gene Encoded By | |
| Mass | 26,732 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |