IED ID | IndEnz0002007229 |
Enzyme Type ID | protease007229 |
Protein Name |
Rhomboid protease GlpG EC 3.4.21.105 Intramembrane serine protease |
Gene Name | glpG YPK_0158 |
Organism | Yersinia pseudotuberculosis serotype O:3 (strain YPIII) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia pseudotuberculosis complex Yersinia pseudotuberculosis Yersinia pseudotuberculosis serotype O:3 (strain YPIII) |
Enzyme Sequence | MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQLSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLGGQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ |
Enzyme Length | 278 |
Uniprot Accession Number | B1JHY8 |
Absorption | |
Active Site | ACT_SITE 202; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_01594; ACT_SITE 255; /evidence=ECO:0000255|HAMAP-Rule:MF_01594 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleaves type-1 transmembrane domains using a catalytic dyad composed of serine and histidine that are contributed by different transmembrane domains.; EC=3.4.21.105; Evidence={ECO:0000255|HAMAP-Rule:MF_01594}; |
DNA Binding | |
EC Number | 3.4.21.105 |
Enzyme Function | FUNCTION: Rhomboid-type serine protease that catalyzes intramembrane proteolysis. {ECO:0000255|HAMAP-Rule:MF_01594}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Transmembrane (5) |
Keywords | Cell inner membrane;Cell membrane;Hydrolase;Membrane;Protease;Serine protease;Transmembrane;Transmembrane helix |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_01594}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_01594}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 31,305 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |