| IED ID | IndEnz0002007232 |
| Enzyme Type ID | protease007232 |
| Protein Name |
Alpha-amylase/subtilisin inhibitor BASI |
| Gene Name | |
| Organism | Hordeum vulgare (Barley) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Pooideae Triticodae Triticeae Hordeinae Hordeum Hordeum vulgare (Barley) |
| Enzyme Sequence | MGSRRAGSSSSPLFWPAPPSRAADPPPVHDTDGHELRADANYYVLSANRAHGGGLTMAPGHGRHCPLFVSQDPNGQHDGFPVRITPYGVAPSDKIIRLSTDVRISFRAYTTCLQSTEWHIDSELAAGRRHVITGPVKDPSPSGRENAFRIEKYSGAEVHEYKLMSCGDWCQDLGVFRDLKGGAWFLGATEPYHVVVFKKAPPA |
| Enzyme Length | 203 |
| Uniprot Accession Number | P07596 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein inhibits independently subtilisin and alpha-amylase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (15); Chain (1); Compositional bias (1); Disulfide bond (2); Frameshift (1); Helix (2); Region (1); Sequence conflict (6); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Alpha-amylase inhibitor;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|Ref.3 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1AVA; 2IWT; 3BX1; |
| Mapped Pubmed ID | 15765494; 17098195; 18556023; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,164 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |